PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013626820.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 306aa    MW: 34328.3 Da    PI: 7.3233
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013626820.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding591.1e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+lv +++ +G+g W+t ++  g++R++k+c++rw +yl
   XP_013626820.1 14 KGPWTPEEDEKLVSYIQAHGPGKWRTLPKNAGLKRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding52.89e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg ++ +E+e +++++++lG++ W++Ia +++ gRt++++k++w+++
   XP_013626820.1  67 RGEFSLQEEETIIQLHRLLGNK-WSAIAIHLP-GRTDNEIKNYWNTH 111
                      899*******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-25764IPR009057Homeodomain-like
PROSITE profilePS5129419.024961IPR017930Myb domain
SuperFamilySSF466892.25E-3012108IPR009057Homeodomain-like
SMARTSM007175.2E-151363IPR001005SANT/Myb domain
PfamPF002492.0E-161461IPR001005SANT/Myb domain
CDDcd001671.61E-111661No hitNo description
PROSITE profilePS5129425.8462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.9E-2665116IPR009057Homeodomain-like
SMARTSM007174.7E-1666114IPR001005SANT/Myb domain
PfamPF002491.5E-1567111IPR001005SANT/Myb domain
CDDcd001671.58E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MGKSSSSEES EVKKGPWTPE EDEKLVSYIQ AHGPGKWRTL PKNAGLKRCG KSCRLRWTNY  60
LRPDIKRGEF SLQEEETIIQ LHRLLGNKWS AIAIHLPGRT DNEIKNYWNT HIKKKLLRMG  120
IDPVTHCPRI NLLQLSSFLT SSLFKSMSQP VNIPFGLANT SINPELLNQL NTSLSNVQTE  180
SYQPHQANQQ LQNDHQTSFT GLLNSTPPVQ WQNNGECLEN YLSYTVSGGQ SINQVPLTGN  240
YSSAINDGEN YKVGWNFSSS MLPSSSTPLN SSSTSFINVG SEDDKESYGS DMLMFHHHDN  300
NALNLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-291111624128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00563DAPTransfer from AT5G54230Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013626820.10.0PREDICTED: transcription repressor MYB4
RefseqXP_013740384.10.0PREDICTED: transcription repressor MYB4-like
TrEMBLA0A078JIC60.0A0A078JIC6_BRANA; BnaC03g71860D protein
TrEMBLA0A0D3B3J20.0A0A0D3B3J2_BRAOL; Uncharacterized protein
STRINGBra029033.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM144651722
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G54230.11e-146myb domain protein 49